PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA11G13750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 325aa    MW: 34099.1 Da    PI: 8.4015
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA11G13750.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP98.17.9e-31871422378
                      --HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP  23 vCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      vCe+h+k+pvv+v+g+eqrfCqqCsrfh+l efD++k+sCr+rL++hn+rrrk+q+
  ONIVA11G13750.1  87 VCEAHAKTPVVVVAGQEQRFCQQCSRFHNLAEFDDGKKSCRKRLDGHNRRRRKPQH 142
                      9****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114121.91463140IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-2786144IPR004333Transcription factor, SBP-box
PfamPF031103.0E-2487139IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.106.6E-2187127IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MEWAAAATKA ASWGMAVAAA AAAADDAGPT MLSFAGPSSS SSSPDAAAAA AAAAALHDFS  60
VRARPAAAAP ATRRALGRRV PVGPQPVCEA HAKTPVVVVA GQEQRFCQQC SRFHNLAEFD  120
DGKKSCRKRL DGHNRRRRKP QHDALNPRSF LPYHQANQFS VYPQTFPIAD QNADALMRPL  180
DRHPPFSISF SGTFREPKQF PFMQDGGSGL GAARHDLLRP FSSPEDGANI TTTRSACNGV  240
PHGLDPECAL SLLSSSLHPS PAAGISSATA PPQFAPSSFS RIAASSQAVT TAFASDGGSV  300
AGDHVLVPAV TYEDPSQAMP FSWQQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-19861393184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122139KKSCRKRLDGHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1336080.0AC133608.4 Oryza sativa Japonica Group chromosome 11 clone OSJNBb0085G12, complete sequence.
GenBankAC1355690.0AC135569.6 Oryza sativa Japonica Group chromosome 11 clone OSJNBb0018F17, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617950.11e-172PREDICTED: putative squamosa promoter-binding-like protein 19
SwissprotQ2R3Y11e-174SPL19_ORYSJ; Putative squamosa promoter-binding-like protein 19
TrEMBLA0A0E0J2610.0A0A0E0J261_ORYNI; Uncharacterized protein
STRINGORGLA11G0121600.11e-175(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.17e-27SBP family protein